PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0303s0047.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 310aa    MW: 34048.5 Da    PI: 8.3412
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0303s0047.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.64.3e-312275255
              G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         prlrWtpeLH +Fv+a+++LGG+ kAtPk +l+lm+v gLt+++vkSHLQ+YR+
  Kalax.0303s0047.1.p 22 PRLRWTPELHCCFVQAIHRLGGQAKATPKLVLQLMNVRGLTISNVKSHLQMYRS 75
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.4551878IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-301879IPR009057Homeodomain-like
SuperFamilySSF466894.48E-152077IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-232276IPR006447Myb domain, plants
PfamPF002491.1E-82374IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MVGCGRNGGG RGVRQYVRSK VPRLRWTPEL HCCFVQAIHR LGGQAKATPK LVLQLMNVRG  60
LTISNVKSHL QMYRSMKSHL RRHDLNSSHI GKHSFEDHDG NGDVDEEQDD DDYHQMNLHH  120
HFLKPTSESD PHFIYSKSVY CINPPKRARI GMSGARSVSE KDTRVVVVHD HRRAGGIIYD  180
TVIPPAAAGP LTSSLSMLLS QNRYNSTINA PLGFPVKESD FLQVVNKVSQ NGCERRMICK  240
AETGDDDPMG TSLSLSLVHP STNGSVMCST SEASETVLSS LPTYSKGSSN FFIDQCSVNL  300
DLSIALCGT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002281928.16e-67PREDICTED: myb family transcription factor APL isoform X2
TrEMBLD7SMG86e-67D7SMG8_VITVI; Putative uncharacterized protein
STRINGVIT_01s0137g00050.t012e-66(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.16e-27G2-like family protein